Lineage for d2plc__ (2plc -)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 476581Superfamily c.1.18: PLC-like phosphodiesterases [51695] (3 families) (S)
  5. 476605Family c.1.18.2: Bacterial PLC [51699] (1 protein)
  6. 476606Protein Phosphatidylinositol-specific phospholipase C [51700] (2 species)
  7. 476617Species Listeria monocytogenes [TaxId:1639] [51702] (2 PDB entries)
  8. 476618Domain d2plc__: 2plc - [29614]

Details for d2plc__

PDB Entry: 2plc (more details), 2 Å

PDB Description: phosphatidylinositol-specific phospholipase c from listeria monocytogenes

SCOP Domain Sequences for d2plc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2plc__ c.1.18.2 (-) Phosphatidylinositol-specific phospholipase C {Listeria monocytogenes}
vttkqwmsalpdttnlaalsipgthdtmsyngditwtltkplaqtqtmslyqqleagiry
idirakdnlniyhgpiflnaslsgvletitqflkknpketiimrlkdeqnsndsfdyriq
pliniykdyfyttprtdtsnkiptlkdvrgkilllsenhtkkplvinsrkfgmqfgapnq
viqddyngpsvktkfkeivqtayqaskadnklflnhisatsltftprqyaaalnnkveqf
vlnltsekvrglgilimdfpekqtikniiknnkf

SCOP Domain Coordinates for d2plc__:

Click to download the PDB-style file with coordinates for d2plc__.
(The format of our PDB-style files is described here.)

Timeline for d2plc__: