Lineage for d2plc__ (2plc -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.18: Phosphatidylinositol-specific phospholipase C (PI-PLC) [51695] (2 families) 
Family c.1.18.2: Bacterial PLC [51699] (1 protein) Protein Phosphatidylinositol-specific phospholipase C [51700] (2 species) Species Listeria monocytogenes [TaxId:1639] [51702] (2 PDB entries) 
Domain d2plc__: 2plc - [29614]
Details for d2plc__
PDB Entry: 2plc (more details), 2 Å
PDB Description: phosphatidylinositol-specific phospholipase c from listeria monocytogenes
SCOP Domain Sequences for d2plc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2plc__ c.1.18.2 (-) Phosphatidylinositol-specific phospholipase C {Listeria monocytogenes}
vttkqwmsalpdttnlaalsipgthdtmsyngditwtltkplaqtqtmslyqqleagiry
idirakdnlniyhgpiflnaslsgvletitqflkknpketiimrlkdeqnsndsfdyriq
pliniykdyfyttprtdtsnkiptlkdvrgkilllsenhtkkplvinsrkfgmqfgapnq
viqddyngpsvktkfkeivqtayqaskadnklflnhisatsltftprqyaaalnnkveqf
vlnltsekvrglgilimdfpekqtikniiknnkf
SCOP Domain Coordinates for d2plc__:
Click to download the PDB-style file with coordinates for d2plc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2plc__:
- d2plc__ first appeared (with stable ids) in SCOP 1.55
- d2plc__ appears in SCOP 1.59
- d2plc__ appears in the current release, SCOPe 2.08, called d2plca_
View in 3D