![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) ![]() |
![]() | Family c.1.18.2: Bacterial PLC [51699] (2 proteins) |
![]() | Protein Phosphatidylinositol-specific phospholipase C [51700] (2 species) |
![]() | Species Listeria monocytogenes [TaxId:1639] [51702] (2 PDB entries) |
![]() | Domain d2plca_: 2plc A: [29614] |
PDB Entry: 2plc (more details), 2 Å
SCOPe Domain Sequences for d2plca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2plca_ c.1.18.2 (A:) Phosphatidylinositol-specific phospholipase C {Listeria monocytogenes [TaxId: 1639]} vttkqwmsalpdttnlaalsipgthdtmsyngditwtltkplaqtqtmslyqqleagiry idirakdnlniyhgpiflnaslsgvletitqflkknpketiimrlkdeqnsndsfdyriq pliniykdyfyttprtdtsnkiptlkdvrgkilllsenhtkkplvinsrkfgmqfgapnq viqddyngpsvktkfkeivqtayqaskadnklflnhisatsltftprqyaaalnnkveqf vlnltsekvrglgilimdfpekqtikniiknnkf
Timeline for d2plca_: