Lineage for d2plca_ (2plc A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) 
Family c.1.18.2: Bacterial PLC [51699] (2 proteins) Protein Phosphatidylinositol-specific phospholipase C [51700] (2 species) Species Listeria monocytogenes [TaxId:1639] [51702] (2 PDB entries) 
Domain d2plca_: 2plc A: [29614]
Details for d2plca_
PDB Entry: 2plc (more details), 2 Å
PDB Description: phosphatidylinositol-specific phospholipase c from listeria monocytogenes
PDB Compounds: (A:) phosphatidylinositol-specific phospholipase cSCOPe Domain Sequences for d2plca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2plca_ c.1.18.2 (A:) Phosphatidylinositol-specific phospholipase C {Listeria monocytogenes [TaxId: 1639]}
vttkqwmsalpdttnlaalsipgthdtmsyngditwtltkplaqtqtmslyqqleagiry
idirakdnlniyhgpiflnaslsgvletitqflkknpketiimrlkdeqnsndsfdyriq
pliniykdyfyttprtdtsnkiptlkdvrgkilllsenhtkkplvinsrkfgmqfgapnq
viqddyngpsvktkfkeivqtayqaskadnklflnhisatsltftprqyaaalnnkveqf
vlnltsekvrglgilimdfpekqtikniiknnkf
SCOPe Domain Coordinates for d2plca_:
Click to download the PDB-style file with coordinates for d2plca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2plca_:
- d2plca_ first appeared (with stable ids) in SCOP 1.55, called d2plc__
- d2plca_ appears in SCOPe 2.07
View in 3D