Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) |
Family c.1.18.2: Bacterial PLC [51699] (2 proteins) |
Protein Phosphatidylinositol-specific phospholipase C [51700] (2 species) |
Species Bacillus cereus [TaxId:1396] [51701] (9 PDB entries) |
Domain d1ptga_: 1ptg A: [29612] complexed with ins |
PDB Entry: 1ptg (more details), 2.6 Å
SCOPe Domain Sequences for d1ptga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ptga_ c.1.18.2 (A:) Phosphatidylinositol-specific phospholipase C {Bacillus cereus [TaxId: 1396]} assvnelenwskwmqpipdsiplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed mkgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpd netftttvnqnanvtvqdkykvsydekvksikdtmdetmnnsedlnhlyinftslssggt awnspyyyasyinpeianyikqknparvgwviqdyinekwspllyqeviranksli
Timeline for d1ptga_: