SCOPe 2.06: Domain d1ptga_: 1ptg A:

Lineage for d1ptga_ (1ptg A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families)

5. Family c.1.18.2: Bacterial PLC [51699] (2 proteins)

6. Protein Phosphatidylinositol-specific phospholipase C [51700] (2 species)

7. Species Bacillus cereus [TaxId:1396] [51701] (9 PDB entries)

8. Domain d1ptga_: 1ptg A: [29612]
   complexed with ins

Details for d1ptga_

PDB Entry: 1ptg, 2.6 Å

PDB Description: phosphatidylinositol-specific phospholipase c in complex with myo-inositol

PDB Compounds: (A:) phosphatidylinositol-specific phospholipase c

SCOPe Domain Sequences for d1ptga_:

Sequence; same for both SEQRES and ATOM records:

>d1ptga_ c.1.18.2 (A:) Phosphatidylinositol-specific phospholipase C {Bacillus cereus [TaxId: 1396]}
assvnelenwskwmqpipdsiplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
mkgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpd
netftttvnqnanvtvqdkykvsydekvksikdtmdetmnnsedlnhlyinftslssggt
awnspyyyasyinpeianyikqknparvgwviqdyinekwspllyqeviranksli

Timeline for d1ptga_:

• d1ptga_ first appeared (with stable ids) in SCOP 1.55, called d1ptg__
  
• d1ptga_ appears in SCOPe 2.05
  
• d1ptga_ appears in SCOPe 2.07
  
• d1ptga_ appears in the current release, SCOPe 2.08