Lineage for d1ptg__ (1ptg -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.18: Phosphatidylinositol-specific phospholipase C (PI-PLC) [51695] (2 families) 
Family c.1.18.2: Bacterial PLC [51699] (1 protein) Protein Phosphatidylinositol-specific phospholipase C [51700] (2 species) 
Species Bacillus cereus [TaxId:1396] [51701] (9 PDB entries) 
Domain d1ptg__: 1ptg - [29612]
Details for d1ptg__
PDB Entry: 1ptg (more details), 2.6 Å
PDB Description: phosphatidylinositol-specific phospholipase c in complex with myo-inositol
SCOP Domain Sequences for d1ptg__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ptg__ c.1.18.2 (-) Phosphatidylinositol-specific phospholipase C {Bacillus cereus}
assvnelenwskwmqpipdsiplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
mkgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpd
netftttvnqnanvtvqdkykvsydekvksikdtmdetmnnsedlnhlyinftslssggt
awnspyyyasyinpeianyikqknparvgwviqdyinekwspllyqeviranksli
SCOP Domain Coordinates for d1ptg__:
Click to download the PDB-style file with coordinates for d1ptg__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ptg__:
- d1ptg__ first appeared (with stable ids) in SCOP 1.55
- d1ptg__ appears in SCOP 1.59
- d1ptg__ appears in the current release, SCOPe 2.08, called d1ptga_
View in 3D