Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.18: PLC-like phosphodiesterases [51695] (3 families) |
Family c.1.18.2: Bacterial PLC [51699] (1 protein) |
Protein Phosphatidylinositol-specific phospholipase C [51700] (2 species) |
Species Bacillus cereus [TaxId:1396] [51701] (9 PDB entries) |
Domain d6ptd__: 6ptd - [29611] mutant |
PDB Entry: 6ptd (more details), 2.6 Å
SCOP Domain Sequences for d6ptd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ptd__ c.1.18.2 (-) Phosphatidylinositol-specific phospholipase C {Bacillus cereus} assvnelenwskwmqpipdsiplarisipgtldsgtfklqnpikqvwgmtqeydfryqmd hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed mkgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpd netftttvnqnanvtvqdkykvsydekvksikdtmdetmnnsedlnhlyinftslssggt awnspyyyasyinpeianyikqknparvgwviqdyinekwspllyqeviranksli
Timeline for d6ptd__: