Lineage for d6ptd__ (6ptd -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19844Superfamily c.1.18: Phosphatidylinositol-specific phospholipase C (PI-PLC) [51695] (2 families) (S)
  5. 19868Family c.1.18.2: Bacterial PLC [51699] (1 protein)
  6. 19869Protein Phosphatidylinositol-specific phospholipase C [51700] (2 species)
  7. 19870Species Bacillus cereus [TaxId:1396] [51701] (9 PDB entries)
  8. 19877Domain d6ptd__: 6ptd - [29611]

Details for d6ptd__

PDB Entry: 6ptd (more details), 2.6 Å

PDB Description: phosphatidylinositol-specific phospholipase c mutant h32l

SCOP Domain Sequences for d6ptd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ptd__ c.1.18.2 (-) Phosphatidylinositol-specific phospholipase C {Bacillus cereus}
assvnelenwskwmqpipdsiplarisipgtldsgtfklqnpikqvwgmtqeydfryqmd
hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
mkgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpd
netftttvnqnanvtvqdkykvsydekvksikdtmdetmnnsedlnhlyinftslssggt
awnspyyyasyinpeianyikqknparvgwviqdyinekwspllyqeviranksli

SCOP Domain Coordinates for d6ptd__:

Click to download the PDB-style file with coordinates for d6ptd__.
(The format of our PDB-style files is described here.)

Timeline for d6ptd__: