SCOP 1.69: Domain d1ptd__: 1ptd -

Lineage for d1ptd__ (1ptd -)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.18: PLC-like phosphodiesterases [51695] (3 families)

5. Family c.1.18.2: Bacterial PLC [51699] (1 protein)

6. Protein Phosphatidylinositol-specific phospholipase C [51700] (2 species)

7. Species Bacillus cereus [TaxId:1396] [51701] (9 PDB entries)

8. Domain d1ptd__: 1ptd - [29609]

Details for d1ptd__

PDB Entry: 1ptd, 2.6 Å

PDB Description: phosphatidylinositol-specific phospholipase c

SCOP Domain Sequences for d1ptd__:

Sequence; same for both SEQRES and ATOM records:

>d1ptd__ c.1.18.2 (-) Phosphatidylinositol-specific phospholipase C {Bacillus cereus}
assvnelenwskwmqpipdsiplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
mkgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpd
netftttvnqnanvtvqdkykvsydekvksikdtmdetmnnsedlnhlyinftslssggt
awnspyyyasyinpeianyikqknparvgwviqdyinekwspllyqeviranksli

Timeline for d1ptd__:

• d1ptd__ first appeared (with stable ids) in SCOP 1.55
  
• d1ptd__ appears in SCOP 1.67
  
• d1ptd__ appears in SCOP 1.71
  
• d1ptd__ appears in the current release, SCOPe 2.08, called d1ptda_