SCOP 1.71: Domain d3ptd__: 3ptd -

Lineage for d3ptd__ (3ptd -)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.18: PLC-like phosphodiesterases [51695] (3 families)

5. Family c.1.18.2: Bacterial PLC [51699] (1 protein)

6. Protein Phosphatidylinositol-specific phospholipase C [51700] (2 species)

7. Species Bacillus cereus [TaxId:1396] [51701] (9 PDB entries)

8. Domain d3ptd__: 3ptd - [29607]
   mutant

Details for d3ptd__

PDB Entry: 3ptd, 2.2 Å

PDB Description: phosphatidylinositol-specific phospholipase c mutant d274s

SCOP Domain Sequences for d3ptd__:

Sequence; same for both SEQRES and ATOM records:

>d3ptd__ c.1.18.2 (-) Phosphatidylinositol-specific phospholipase C {Bacillus cereus}
assvnelenwskwmqpipdsiplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
mkgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpd
netftttvnqnanvtvqdkykvsydekvksikdtmdetmnnsedlnhlyinftslssggt
awnspyyyasyinpeianyikqknparvgwviqsyinekwspllyqeviranksli

Timeline for d3ptd__:

• d3ptd__ first appeared (with stable ids) in SCOP 1.55
  
• d3ptd__ appears in SCOP 1.69
  
• d3ptd__ is called d3ptda_ in SCOP 1.73
  
• d3ptd__ appears in the current release, SCOPe 2.08, called d3ptda_