Lineage for d3ptd__ (3ptd -)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 386731Superfamily c.1.18: PLC-like phosphodiesterases [51695] (3 families) (S)
  5. 386755Family c.1.18.2: Bacterial PLC [51699] (1 protein)
  6. 386756Protein Phosphatidylinositol-specific phospholipase C [51700] (2 species)
  7. 386757Species Bacillus cereus [TaxId:1396] [51701] (9 PDB entries)
  8. 386759Domain d3ptd__: 3ptd - [29607]
    mutant

Details for d3ptd__

PDB Entry: 3ptd (more details), 2.2 Å

PDB Description: phosphatidylinositol-specific phospholipase c mutant d274s

SCOP Domain Sequences for d3ptd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ptd__ c.1.18.2 (-) Phosphatidylinositol-specific phospholipase C {Bacillus cereus}
assvnelenwskwmqpipdsiplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
mkgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpd
netftttvnqnanvtvqdkykvsydekvksikdtmdetmnnsedlnhlyinftslssggt
awnspyyyasyinpeianyikqknparvgwviqsyinekwspllyqeviranksli

SCOP Domain Coordinates for d3ptd__:

Click to download the PDB-style file with coordinates for d3ptd__.
(The format of our PDB-style files is described here.)

Timeline for d3ptd__: