Lineage for d1gym__ (1gym -)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 573766Superfamily c.1.18: PLC-like phosphodiesterases [51695] (3 families) (S)
  5. 573790Family c.1.18.2: Bacterial PLC [51699] (1 protein)
  6. 573791Protein Phosphatidylinositol-specific phospholipase C [51700] (2 species)
  7. 573792Species Bacillus cereus [TaxId:1396] [51701] (9 PDB entries)
  8. 573795Domain d1gym__: 1gym - [29606]
    complexed with myg

Details for d1gym__

PDB Entry: 1gym (more details), 2.2 Å

PDB Description: phosphatidylinositol-specific phospholipase c in complex with glucosamine-(alpha-1-6)-myo-inositol

SCOP Domain Sequences for d1gym__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gym__ c.1.18.2 (-) Phosphatidylinositol-specific phospholipase C {Bacillus cereus}
assvnelenwskwmqpipdsiplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
mkgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpd
netftttvnqnanvtvqdkykvsydekvksikdtmdetmnnsedlnhlyinftslssggt
awnspyyyasyinpeianyikqknparvgwviqdyinekwspllyqeviranksli

SCOP Domain Coordinates for d1gym__:

Click to download the PDB-style file with coordinates for d1gym__.
(The format of our PDB-style files is described here.)

Timeline for d1gym__: