Lineage for d2ptd__ (2ptd -)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 573766Superfamily c.1.18: PLC-like phosphodiesterases [51695] (3 families) (S)
  5. 573790Family c.1.18.2: Bacterial PLC [51699] (1 protein)
  6. 573791Protein Phosphatidylinositol-specific phospholipase C [51700] (2 species)
  7. 573792Species Bacillus cereus [TaxId:1396] [51701] (9 PDB entries)
  8. 573793Domain d2ptd__: 2ptd - [29605]
    mutant

Details for d2ptd__

PDB Entry: 2ptd (more details), 2 Å

PDB Description: phosphatidylinositol-specific phospholipase c mutant d198e

SCOP Domain Sequences for d2ptd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ptd__ c.1.18.2 (-) Phosphatidylinositol-specific phospholipase C {Bacillus cereus}
assvnelenwskwmqpipdsiplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
mkgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpd
netftttvnqnanvtvqekykvsydekvksikdtmdetmnnsedlnhlyinftslssggt
awnspyyyasyinpeianyikqknparvgwviqdyinekwspllyqeviranksli

SCOP Domain Coordinates for d2ptd__:

Click to download the PDB-style file with coordinates for d2ptd__.
(The format of our PDB-style files is described here.)

Timeline for d2ptd__: