Lineage for d2ptda_ (2ptd A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839880Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2839909Family c.1.18.2: Bacterial PLC [51699] (2 proteins)
  6. 2839910Protein Phosphatidylinositol-specific phospholipase C [51700] (2 species)
  7. 2839911Species Bacillus cereus [TaxId:1396] [51701] (9 PDB entries)
  8. 2839912Domain d2ptda_: 2ptd A: [29605]
    mutant

Details for d2ptda_

PDB Entry: 2ptd (more details), 2 Å

PDB Description: phosphatidylinositol-specific phospholipase c mutant d198e
PDB Compounds: (A:) phosphatidylinositol-specific phospholipase c

SCOPe Domain Sequences for d2ptda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ptda_ c.1.18.2 (A:) Phosphatidylinositol-specific phospholipase C {Bacillus cereus [TaxId: 1396]}
assvnelenwskwmqpipdsiplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
mkgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpd
netftttvnqnanvtvqekykvsydekvksikdtmdetmnnsedlnhlyinftslssggt
awnspyyyasyinpeianyikqknparvgwviqdyinekwspllyqeviranksli

SCOPe Domain Coordinates for d2ptda_:

Click to download the PDB-style file with coordinates for d2ptda_.
(The format of our PDB-style files is described here.)

Timeline for d2ptda_: