Lineage for d1djyb3 (1djy B:299-625)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65990Superfamily c.1.18: Phosphatidylinositol-specific phospholipase C (PI-PLC) [51695] (2 families) (S)
  5. 65991Family c.1.18.1: Mammalian PLC [51696] (1 protein)
  6. 65992Protein Phospholipase C isozyme D1 (PLC-D1) [51697] (1 species)
  7. 65993Species Rat (Rattus norvegicus) [TaxId:10116] [51698] (10 PDB entries)
  8. 66009Domain d1djyb3: 1djy B:299-625 [29602]
    Other proteins in same PDB: d1djya1, d1djya2, d1djyb1, d1djyb2

Details for d1djyb3

PDB Entry: 1djy (more details), 2.8 Å

PDB Description: phosphoinositide-specific phospholipase c-delta1 from rat complexed with inositol-2,4,5-trisphosphate

SCOP Domain Sequences for d1djyb3:

Sequence, based on SEQRES records: (download)

>d1djyb3 c.1.18.1 (B:299-625) Phospholipase C isozyme D1 (PLC-D1) {Rat (Rattus norvegicus)}
dqplshylvssshntylledqltgpssteayiralckgcrcleldcwdgpnqepiiyhgy
tftskilfcdvlrairdyafkaspypvilslenhcsleqqrvmarhlrailgpilldqpl
dgvttslpspeqlkgkillkgkklggllpaggengseatdvsdeveaaemedeavrsqvq
hkpkedklklvpelsdmiiycksvhfggfsspgtsgqafyemasfsesralrllqesgng
fvrhnvsclsriypagwrtdssnyspvemwnggcqivalnfqtpgpemdvylgcfqdngg
cgyvlkpaflrdpnttfnsraltqgpw

Sequence, based on observed residues (ATOM records): (download)

>d1djyb3 c.1.18.1 (B:299-625) Phospholipase C isozyme D1 (PLC-D1) {Rat (Rattus norvegicus)}
dqplshylvssshntylledqltgpssteayiralckgcrcleldcwdgpnqepiiyhgy
tftskilfcdvlrairdyafkaspypvilslenhcsleqqrvmarhlrailgpilldqpl
dgvttslpspeqlkgkillkgkklggldklklvpelsdmiiycksvhfggfsspgtsgqa
fyemasfsesralrllqesgngfvrhnvsclsriypagwrtdssnyspvemwnggcqiva
lnfqtpgpemdvylgcfqdnggcgyvlkpaflrdpnttfnsraltqgpw

SCOP Domain Coordinates for d1djyb3:

Click to download the PDB-style file with coordinates for d1djyb3.
(The format of our PDB-style files is described here.)

Timeline for d1djyb3: