Lineage for d1djya3 (1djy A:299-625)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19844Superfamily c.1.18: Phosphatidylinositol-specific phospholipase C (PI-PLC) [51695] (2 families) (S)
  5. 19845Family c.1.18.1: Mammalian PLC [51696] (1 protein)
  6. 19846Protein Phospholipase C isozyme D1 (PLC-D1) [51697] (1 species)
  7. 19847Species Rat (Rattus norvegicus) [TaxId:10116] [51698] (10 PDB entries)
  8. 19864Domain d1djya3: 1djy A:299-625 [29601]
    Other proteins in same PDB: d1djya1, d1djya2, d1djyb1, d1djyb2

Details for d1djya3

PDB Entry: 1djy (more details), 2.8 Å

PDB Description: phosphoinositide-specific phospholipase c-delta1 from rat complexed with inositol-2,4,5-trisphosphate

SCOP Domain Sequences for d1djya3:

Sequence, based on SEQRES records: (download)

>d1djya3 c.1.18.1 (A:299-625) Phospholipase C isozyme D1 (PLC-D1) {Rat (Rattus norvegicus)}
dqplshylvssshntylledqltgpssteayiralckgcrcleldcwdgpnqepiiyhgy
tftskilfcdvlrairdyafkaspypvilslenhcsleqqrvmarhlrailgpilldqpl
dgvttslpspeqlkgkillkgkklggllpaggengseatdvsdeveaaemedeavrsqvq
hkpkedklklvpelsdmiiycksvhfggfsspgtsgqafyemasfsesralrllqesgng
fvrhnvsclsriypagwrtdssnyspvemwnggcqivalnfqtpgpemdvylgcfqdngg
cgyvlkpaflrdpnttfnsraltqgpw

Sequence, based on observed residues (ATOM records): (download)

>d1djya3 c.1.18.1 (A:299-625) Phospholipase C isozyme D1 (PLC-D1) {Rat (Rattus norvegicus)}
dqplshylvssshntylledqltgpssteayiralckgcrcleldcwdgpnqepiiyhgy
tftskilfcdvlrairdyafkaspypvilslenhcsleqqrvmarhlrailgpilldqpl
dgvttslpspeqlkgkillkgkklklvpelsdmiiycksvhfggfsspgtsgqafyemas
fsesralrllqesgngfvrhnvsclsriypagwrtdssnyspvemwnggcqivalnfqtp
gpemdvylgcfqdnggcgyvlkpaflrdpnttfnsraltqgpw

SCOP Domain Coordinates for d1djya3:

Click to download the PDB-style file with coordinates for d1djya3.
(The format of our PDB-style files is described here.)

Timeline for d1djya3: