Lineage for d1qatb3 (1qat B:299-625)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19844Superfamily c.1.18: Phosphatidylinositol-specific phospholipase C (PI-PLC) [51695] (2 families) (S)
  5. 19845Family c.1.18.1: Mammalian PLC [51696] (1 protein)
  6. 19846Protein Phospholipase C isozyme D1 (PLC-D1) [51697] (1 species)
  7. 19847Species Rat (Rattus norvegicus) [TaxId:10116] [51698] (10 PDB entries)
  8. 19863Domain d1qatb3: 1qat B:299-625 [29600]
    Other proteins in same PDB: d1qata1, d1qata2, d1qatb1, d1qatb2

Details for d1qatb3

PDB Entry: 1qat (more details), 3 Å

PDB Description: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta complex with samarium (iii) chloride

SCOP Domain Sequences for d1qatb3:

Sequence, based on SEQRES records: (download)

>d1qatb3 c.1.18.1 (B:299-625) Phospholipase C isozyme D1 (PLC-D1) {Rat (Rattus norvegicus)}
dqplshylvssshntylledqltgpssteayiralckgcrcleldcwdgpnqepiiyhgy
tftskilfcdvlrairdyafkaspypvilslenhcsleqqrvmarhlrailgpilldqpl
dgvttslpspeqlkgkillkgkklggllpaggengseatdvsdeveaaemedeavrsqvq
hkpkedklklvpelsdmiiycksvhfggfsspgtsgqafyemasfsesralrllqesgng
fvrhnvsclsriypagwrtdssnyspvemwnggcqivalnfqtpgpemdvylgcfqdngg
cgyvlkpaflrdpnttfnsraltqgpw

Sequence, based on observed residues (ATOM records): (download)

>d1qatb3 c.1.18.1 (B:299-625) Phospholipase C isozyme D1 (PLC-D1) {Rat (Rattus norvegicus)}
dqplshylvssshntylledqltgpssteayiralckgcrcleldcwdgpnqepiiyhgy
tftskilfcdvlrairdyafkaspypvilslenhcsleqqrvmarhlrailgpilldqpl
dgvttslpspeqlkgkillkgkklggllklvpelsdmiiycksvhfggfssgqafyemas
fsesralrllqesgngfvrhnvsclsriypagwrtdssnyspvemwnggcqivalnfqtp
gpemdvylgcfqdnggcgyvlkpaflrdpnttfnsraltqgpw

SCOP Domain Coordinates for d1qatb3:

Click to download the PDB-style file with coordinates for d1qatb3.
(The format of our PDB-style files is described here.)

Timeline for d1qatb3: