Lineage for d2isda3 (2isd A:299-625)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089342Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2089343Family c.1.18.1: Mammalian PLC [51696] (2 protein domains)
  6. 2089344Protein Phospholipase C isozyme D1 (PLC-D1) [51697] (1 species)
  7. 2089345Species Norway rat (Rattus norvegicus) [TaxId:10116] [51698] (11 PDB entries)
  8. 2089358Domain d2isda3: 2isd A:299-625 [29597]
    Other proteins in same PDB: d2isda1, d2isda2, d2isdb1, d2isdb2
    complexed with act

Details for d2isda3

PDB Entry: 2isd (more details), 2.5 Å

PDB Description: phosphoinositide-specific phospholipase c-delta1 from rat
PDB Compounds: (A:) phosphoinositide-specific phospholipase c, isozyme delta1

SCOPe Domain Sequences for d2isda3:

Sequence, based on SEQRES records: (download)

>d2isda3 c.1.18.1 (A:299-625) Phospholipase C isozyme D1 (PLC-D1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dqplshylvssshntylledqltgpssteayiralckgcrcleldcwdgpnqepiiyhgy
tftskilfcdvlrairdyafkaspypvilslenhcsleqqrvmarhlrailgpilldqpl
dgvttslpspeqlkgkillkgkklggllpaggengseatdvsdeveaaemedeavrsqvq
hkpkedklklvpelsdmiiycksvhfggfsspgtsgqafyemasfsesralrllqesgng
fvrhnvsclsriypagwrtdssnyspvemwnggcqivalnfqtpgpemdvylgcfqdngg
cgyvlkpaflrdpnttfnsraltqgpw

Sequence, based on observed residues (ATOM records): (download)

>d2isda3 c.1.18.1 (A:299-625) Phospholipase C isozyme D1 (PLC-D1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dqplshylvssshntylledqltgpssteayiralckgcrcleldcwdgpnqepiiyhgy
tftskilfcdvlrairdyafkaspypvilslenhcsleqqrvmarhlrailgpilldqpl
dgvttslpspeqlkgkillkgkklklvpelsdmiiycksvhfggfsspgtsgqafyemas
fsesralrllqesgngfvrhnvsclsriypagwrtdssnyspvemwnggcqivalnfqtp
gpemdvylgcfqdnggcgyvlkpaflrdpnttfnsraltqgpw

SCOPe Domain Coordinates for d2isda3:

Click to download the PDB-style file with coordinates for d2isda3.
(The format of our PDB-style files is described here.)

Timeline for d2isda3: