Lineage for d1qasa3 (1qas A:299-625)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19844Superfamily c.1.18: Phosphatidylinositol-specific phospholipase C (PI-PLC) [51695] (2 families) (S)
  5. 19845Family c.1.18.1: Mammalian PLC [51696] (1 protein)
  6. 19846Protein Phospholipase C isozyme D1 (PLC-D1) [51697] (1 species)
  7. 19847Species Rat (Rattus norvegicus) [TaxId:10116] [51698] (10 PDB entries)
  8. 19848Domain d1qasa3: 1qas A:299-625 [29585]
    Other proteins in same PDB: d1qasa1, d1qasa2, d1qasb1, d1qasb2

Details for d1qasa3

PDB Entry: 1qas (more details), 2.4 Å

PDB Description: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta 1

SCOP Domain Sequences for d1qasa3:

Sequence, based on SEQRES records: (download)

>d1qasa3 c.1.18.1 (A:299-625) Phospholipase C isozyme D1 (PLC-D1) {Rat (Rattus norvegicus)}
dqplshylvssshntylledqltgpssteayiralckgcrcleldcwdgpnqepiiyhgy
tftskilfcdvlrairdyafkaspypvilslenhcsleqqrvmarhlrailgpilldqpl
dgvttslpspeqlkgkillkgkklggllpaggengseatdvsdeveaaemedeavrsqvq
hkpkedklklvpelsdmiiycksvhfggfsspgtsgqafyemasfsesralrllqesgng
fvrhnvsclsriypagwrtdssnyspvemwnggcqivalnfqtpgpemdvylgcfqdngg
cgyvlkpaflrdpnttfnsraltqgpw

Sequence, based on observed residues (ATOM records): (download)

>d1qasa3 c.1.18.1 (A:299-625) Phospholipase C isozyme D1 (PLC-D1) {Rat (Rattus norvegicus)}
dqplshylvssshntylledqltgpssteayiralckgcrcleldcwdgpnqepiiyhgy
tftskilfcdvlrairdyafkaspypvilslenhcsleqqrvmarhlrailgpilldqpl
dgvttslpspeqlkgkillkgkklggklvpelsdmiiycksvhfggfsspgtsgqafyem
asfsesralrllqesgngfvrhnvsclsriypagwrtdssnyspvemwnggcqivalnfq
tpgpemdvylgcfqdnggcgyvlkpaflrdpnttfnsraltqgpw

SCOP Domain Coordinates for d1qasa3:

Click to download the PDB-style file with coordinates for d1qasa3.
(The format of our PDB-style files is described here.)

Timeline for d1qasa3: