Lineage for d1qasa3 (1qas A:299-625)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089342Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2089343Family c.1.18.1: Mammalian PLC [51696] (2 protein domains)
  6. 2089344Protein Phospholipase C isozyme D1 (PLC-D1) [51697] (1 species)
  7. 2089345Species Norway rat (Rattus norvegicus) [TaxId:10116] [51698] (11 PDB entries)
  8. 2089346Domain d1qasa3: 1qas A:299-625 [29585]
    Other proteins in same PDB: d1qasa1, d1qasa2, d1qasb1, d1qasb2

Details for d1qasa3

PDB Entry: 1qas (more details), 2.4 Å

PDB Description: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta 1
PDB Compounds: (A:) phospholipase c delta-1

SCOPe Domain Sequences for d1qasa3:

Sequence, based on SEQRES records: (download)

>d1qasa3 c.1.18.1 (A:299-625) Phospholipase C isozyme D1 (PLC-D1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dqplshylvssshntylledqltgpssteayiralckgcrcleldcwdgpnqepiiyhgy
tftskilfcdvlrairdyafkaspypvilslenhcsleqqrvmarhlrailgpilldqpl
dgvttslpspeqlkgkillkgkklggllpaggengseatdvsdeveaaemedeavrsqvq
hkpkedklklvpelsdmiiycksvhfggfsspgtsgqafyemasfsesralrllqesgng
fvrhnvsclsriypagwrtdssnyspvemwnggcqivalnfqtpgpemdvylgcfqdngg
cgyvlkpaflrdpnttfnsraltqgpw

Sequence, based on observed residues (ATOM records): (download)

>d1qasa3 c.1.18.1 (A:299-625) Phospholipase C isozyme D1 (PLC-D1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dqplshylvssshntylledqltgpssteayiralckgcrcleldcwdgpnqepiiyhgy
tftskilfcdvlrairdyafkaspypvilslenhcsleqqrvmarhlrailgpilldqpl
dgvttslpspeqlkgkillkgkklggklvpelsdmiiycksvhfggfsspgtsgqafyem
asfsesralrllqesgngfvrhnvsclsriypagwrtdssnyspvemwnggcqivalnfq
tpgpemdvylgcfqdnggcgyvlkpaflrdpnttfnsraltqgpw

SCOPe Domain Coordinates for d1qasa3:

Click to download the PDB-style file with coordinates for d1qasa3.
(The format of our PDB-style files is described here.)

Timeline for d1qasa3: