SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1qasa3 (1qas A:299-625)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089342Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2089343Family c.1.18.1: Mammalian PLC [51696] (2 protein domains)
  6. 2089344Protein Phospholipase C isozyme D1 (PLC-D1) [51697] (1 species)
  7. 2089345Species Norway rat (Rattus norvegicus) [TaxId:10116] [51698] (11 PDB entries)
  8. 2089346Domain d1qasa3: 1qas A:299-625 [29585]
    Other proteins in same PDB: d1qasa1, d1qasa2, d1qasb1, d1qasb2

Details for d1qasa3

PDB Entry: 1qas (more details), 2.4 Å

PDB Description: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta 1
PDB Compounds: (A:) phospholipase c delta-1

SCOPe Domain Sequences for d1qasa3:

Sequence, based on SEQRES records: (download)

>d1qasa3 c.1.18.1 (A:299-625) Phospholipase C isozyme D1 (PLC-D1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dqplshylvssshntylledqltgpssteayiralckgcrcleldcwdgpnqepiiyhgy
tftskilfcdvlrairdyafkaspypvilslenhcsleqqrvmarhlrailgpilldqpl
dgvttslpspeqlkgkillkgkklggllpaggengseatdvsdeveaaemedeavrsqvq
hkpkedklklvpelsdmiiycksvhfggfsspgtsgqafyemasfsesralrllqesgng
fvrhnvsclsriypagwrtdssnyspvemwnggcqivalnfqtpgpemdvylgcfqdngg
cgyvlkpaflrdpnttfnsraltqgpw

Sequence, based on observed residues (ATOM records): (download)

>d1qasa3 c.1.18.1 (A:299-625) Phospholipase C isozyme D1 (PLC-D1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dqplshylvssshntylledqltgpssteayiralckgcrcleldcwdgpnqepiiyhgy
tftskilfcdvlrairdyafkaspypvilslenhcsleqqrvmarhlrailgpilldqpl
dgvttslpspeqlkgkillkgkklggklvpelsdmiiycksvhfggfsspgtsgqafyem
asfsesralrllqesgngfvrhnvsclsriypagwrtdssnyspvemwnggcqivalnfq
tpgpemdvylgcfqdnggcgyvlkpaflrdpnttfnsraltqgpw

SCOPe Domain Coordinates for d1qasa3:

Click to download the PDB-style file with coordinates for d1qasa3.
(The format of our PDB-style files is described here.)

Timeline for d1qasa3: