Lineage for d1qpnd1 (1qpn D:1617-1785)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 476547Superfamily c.1.17: Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51690] (1 family) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 476548Family c.1.17.1: Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51691] (1 protein)
  6. 476549Protein Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51692] (3 species)
  7. 476550Species Mycobacterium tuberculosis [TaxId:1773] [51694] (4 PDB entries)
  8. 476572Domain d1qpnd1: 1qpn D:1617-1785 [29582]
    Other proteins in same PDB: d1qpna2, d1qpnb2, d1qpnc2, d1qpnd2, d1qpne2, d1qpnf2

Details for d1qpnd1

PDB Entry: 1qpn (more details), 2.6 Å

PDB Description: Quinolinate Phosphoribosyl Transferase from Mycobacterium Tuberculosis in Complex with NCNN

SCOP Domain Sequences for d1qpnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpnd1 c.1.17.1 (D:1617-1785) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis}
iatataawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhv
aaagsvvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrr
dsraptvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm

SCOP Domain Coordinates for d1qpnd1:

Click to download the PDB-style file with coordinates for d1qpnd1.
(The format of our PDB-style files is described here.)

Timeline for d1qpnd1: