Lineage for d1qprf1 (1qpr F:117-285)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19813Superfamily c.1.17: Quinolinic acid phosphoribosyltransferase, C-terminal domain [51690] (1 family) (S)
  5. 19814Family c.1.17.1: Quinolinic acid phosphoribosyltransferase, C-terminal domain [51691] (1 protein)
  6. 19815Protein Quinolinic acid phosphoribosyltransferase, C-terminal domain [51692] (2 species)
  7. 19816Species Mycobacterium tuberculosis [TaxId:1773] [51694] (4 PDB entries)
  8. 19834Domain d1qprf1: 1qpr F:117-285 [29578]
    Other proteins in same PDB: d1qpra2, d1qprb2, d1qprc2, d1qprd2, d1qpre2, d1qprf2

Details for d1qprf1

PDB Entry: 1qpr (more details), 2.45 Å

PDB Description: quinolinate phosphoribosyltransferase (qaprtase) from mycobacterium tuberculosis in complex with phthalate and prpcp

SCOP Domain Sequences for d1qprf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qprf1 c.1.17.1 (F:117-285) Quinolinic acid phosphoribosyltransferase, C-terminal domain {Mycobacterium tuberculosis}
iatataawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhv
aaagsvvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrr
dsraptvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm

SCOP Domain Coordinates for d1qprf1:

Click to download the PDB-style file with coordinates for d1qprf1.
(The format of our PDB-style files is described here.)

Timeline for d1qprf1: