![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.17: Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51690] (1 family) ![]() imcomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
![]() | Family c.1.17.1: Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51691] (1 protein) |
![]() | Protein Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51692] (3 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [51694] (4 PDB entries) |
![]() | Domain d1qprd1: 1qpr D:117-285 [29576] Other proteins in same PDB: d1qpra2, d1qprb2, d1qprc2, d1qprd2, d1qpre2, d1qprf2 |
PDB Entry: 1qpr (more details), 2.45 Å
SCOP Domain Sequences for d1qprd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qprd1 c.1.17.1 (D:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis} iatataawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhv aaagsvvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrr dsraptvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
Timeline for d1qprd1: