Lineage for d1qpqf1 (1qpq F:2617-2785)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 386697Superfamily c.1.17: Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51690] (1 family) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 386698Family c.1.17.1: Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51691] (1 protein)
  6. 386699Protein Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51692] (3 species)
  7. 386700Species Mycobacterium tuberculosis [TaxId:1773] [51694] (4 PDB entries)
  8. 386712Domain d1qpqf1: 1qpq F:2617-2785 [29572]
    Other proteins in same PDB: d1qpqa2, d1qpqb2, d1qpqc2, d1qpqd2, d1qpqe2, d1qpqf2
    complexed with ntm, so4

Details for d1qpqf1

PDB Entry: 1qpq (more details), 2.45 Å

PDB Description: Structure of Quinolinic Acid Phosphoribosyltransferase from Mycobacterium Tuberculosis: A Potential TB Drug Target

SCOP Domain Sequences for d1qpqf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpqf1 c.1.17.1 (F:2617-2785) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis}
iatataawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhv
aaagsvvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrr
dsraptvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm

SCOP Domain Coordinates for d1qpqf1:

Click to download the PDB-style file with coordinates for d1qpqf1.
(The format of our PDB-style files is described here.)

Timeline for d1qpqf1: