Lineage for d1qpqb1 (1qpq B:617-785)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 307629Superfamily c.1.17: Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51690] (1 family) (S)
    imcomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 307630Family c.1.17.1: Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51691] (1 protein)
  6. 307631Protein Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51692] (3 species)
  7. 307632Species Mycobacterium tuberculosis [TaxId:1773] [51694] (4 PDB entries)
  8. 307640Domain d1qpqb1: 1qpq B:617-785 [29568]
    Other proteins in same PDB: d1qpqa2, d1qpqb2, d1qpqc2, d1qpqd2, d1qpqe2, d1qpqf2

Details for d1qpqb1

PDB Entry: 1qpq (more details), 2.45 Å

PDB Description: Structure of Quinolinic Acid Phosphoribosyltransferase from Mycobacterium Tuberculosis: A Potential TB Drug Target

SCOP Domain Sequences for d1qpqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpqb1 c.1.17.1 (B:617-785) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis}
iatataawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhv
aaagsvvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrr
dsraptvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm

SCOP Domain Coordinates for d1qpqb1:

Click to download the PDB-style file with coordinates for d1qpqb1.
(The format of our PDB-style files is described here.)

Timeline for d1qpqb1: