Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.389: Menin N-terminal domain-like [310556] (1 superfamily) Some structural similarity to cysteine proteinases (d.3.1.4) noted in PubMed 22327296 |
Superfamily d.389.1: Menin N-terminal domain-like [310582] (1 family) Pfam PF05053 |
Family d.389.1.1: Menin N-terminal domain-like [310623] (2 proteins) |
Protein Menin N-terminal domain [310724] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [310972] (34 PDB entries) |
Domain d3u88b1: 3u88 B:2-230 [295679] Other proteins in same PDB: d3u88a2, d3u88b2, d3u88c_, d3u88d_ automated match to d3u85a1 complexed with 0br, chd, ggb, glv, so4 |
PDB Entry: 3u88 (more details), 3 Å
SCOPe Domain Sequences for d3u88b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u88b1 d.389.1.1 (B:2-230) Menin N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} glkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrviptnvpel tfqpspapdppggltyfpvadlsiiaalyarftaqirgavdlslypreggvssrelvkkv sdviwnslsrsyfkdrahiqslfsfitgtkldssgvafavvgacqalglrdvhlalsedh awvvfgpngeqtaevtwhgkgnedrrgqtvnagvaerswlylkgsymrc
Timeline for d3u88b1:
View in 3D Domains from other chains: (mouse over for more information) d3u88a1, d3u88a2, d3u88c_, d3u88d_ |