SCOPe 2.05: Domain d1qpoe1: 1qpo E:2117-2285

Lineage for d1qpoe1 (1qpo E:2117-2285)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families)
   incomplete beta/alpha barrel with parallel beta-sheet of 7 strands

5. Family c.1.17.1: NadC C-terminal domain-like [51691] (4 proteins)

6. Protein Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51692] (3 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [51694] (4 PDB entries)

8. Domain d1qpoe1: 1qpo E:2117-2285 [29565]
   Other proteins in same PDB: d1qpoa2, d1qpob2, d1qpoc2, d1qpod2, d1qpoe2, d1qpof2
   complexed with so4

Details for d1qpoe1

PDB Entry: 1qpo, 2.4 Å

PDB Description: Quinolinate Phosphoribosyl Transferase (QAPRTase) Apo-Enzyme from Mycobacterium Tuberculosis

PDB Compounds: (E:) quinolinate acid phosphoribosyl transferase

SCOPe Domain Sequences for d1qpoe1:

Sequence; same for both SEQRES and ATOM records:

>d1qpoe1 c.1.17.1 (E:2117-2285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
iatataawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhv
aaagsvvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrr
dsraptvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm

Timeline for d1qpoe1:

• d1qpoe1 first appeared (with stable ids) in SCOP 1.55
  
• d1qpoe1 appears in SCOPe 2.04
  
• d1qpoe1 appears in SCOPe 2.06
  
• d1qpoe1 appears in the current release, SCOPe 2.08