![]() | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) |
![]() | Superfamily c.1.17: Quinolinic acid phosphoribosyltransferase, C-terminal domain [51690] (1 family) ![]() |
![]() | Family c.1.17.1: Quinolinic acid phosphoribosyltransferase, C-terminal domain [51691] (1 protein) |
![]() | Protein Quinolinic acid phosphoribosyltransferase, C-terminal domain [51692] (2 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [51694] (4 PDB entries) |
![]() | Domain d1qpob1: 1qpo B:617-785 [29562] Other proteins in same PDB: d1qpoa2, d1qpob2, d1qpoc2, d1qpod2, d1qpoe2, d1qpof2 |
PDB Entry: 1qpo (more details), 2.4 Å
SCOP Domain Sequences for d1qpob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qpob1 c.1.17.1 (B:617-785) Quinolinic acid phosphoribosyltransferase, C-terminal domain {Mycobacterium tuberculosis} iatataawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhv aaagsvvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrr dsraptvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
Timeline for d1qpob1: