| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.17: Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51690] (1 family) ![]() imcomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
| Family c.1.17.1: Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51691] (1 protein) |
| Protein Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51692] (3 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [51694] (4 PDB entries) |
| Domain d1qpoa1: 1qpo A:117-285 [29561] Other proteins in same PDB: d1qpoa2, d1qpob2, d1qpoc2, d1qpod2, d1qpoe2, d1qpof2 |
PDB Entry: 1qpo (more details), 2.4 Å
SCOP Domain Sequences for d1qpoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis}
iatataawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhv
aaagsvvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrr
dsraptvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
Timeline for d1qpoa1: