SCOPe 2.05: Domain d1qapa1: 1qap A:130-296

Lineage for d1qapa1 (1qap A:130-296)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families)
   incomplete beta/alpha barrel with parallel beta-sheet of 7 strands

5. Family c.1.17.1: NadC C-terminal domain-like [51691] (4 proteins)

6. Protein Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51692] (3 species)

7. Species Salmonella typhimurium [TaxId:90371] [51693] (1 PDB entry)

8. Domain d1qapa1: 1qap A:130-296 [29559]
   Other proteins in same PDB: d1qapa2, d1qapb2
   complexed with ntm

Details for d1qapa1

PDB Entry: 1qap, 2.8 Å

PDB Description: quinolinic acid phosphoribosyltransferase with bound quinolinic acid

PDB Compounds: (A:) quinolinic acid phosphoribosyltransferase

SCOPe Domain Sequences for d1qapa1:

Sequence; same for both SEQRES and ATOM records:

>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
vasevrryvgllagtqtqlldtrktlpglrtalkyavlcggganhrlgltdaflikenhi
iasgsvrqavekafwlhpdvpvevevenldelddalkagadiimldnfntdqmreavkrv
ngqarlevsgnvtaetlrefaetgvdfisvgaltkhvraldlsmrfc

Timeline for d1qapa1:

• d1qapa1 first appeared (with stable ids) in SCOP 1.55
  
• d1qapa1 appears in SCOPe 2.04
  
• d1qapa1 appears in SCOPe 2.06
  
• d1qapa1 appears in the current release, SCOPe 2.08