Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) consists of clearly related families of somewhat different folds |
Family c.1.16.2: Non-fluorescent flavoprotein (luxF, FP390) [51683] (2 proteins) incomplete beta/alpha barrel with mixed beta-sheet of 7 strands |
Protein Non-fluorescent flavoprotein (luxF, FP390) [51684] (2 species) |
Species Photobacterium phosphoreum [TaxId:659] [51686] (1 PDB entry) |
Domain d1fvpb_: 1fvp B: [29557] complexed with fma |
PDB Entry: 1fvp (more details), 2.7 Å
SCOPe Domain Sequences for d1fvpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fvpb_ c.1.16.2 (B:) Non-fluorescent flavoprotein (luxF, FP390) {Photobacterium phosphoreum [TaxId: 659]} mnkwnygvffvnfynkgqqepsktmnnaletlriidedtsiydviniddhylvkkdsedk klapfitlgeklyvlatsentvdiaakyalplvfkwddineerlkllsfynasaskynkn idlvrhqlmlhvnvneaetvakeelklyienyvactqpsnfngsidsiiqsnvtgsykdc lsyvanlagkfdntvdfllcfesmqdqnkkksvmidlnnqvikfrqdnnli
Timeline for d1fvpb_: