SCOPe 2.06: Domain d1fvpa_: 1fvp A:

Lineage for d1fvpa_ (1fvp A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families)
   consists of clearly related families of somewhat different folds

5. Family c.1.16.2: Non-fluorescent flavoprotein (luxF, FP390) [51683] (2 proteins)
   incomplete beta/alpha barrel with mixed beta-sheet of 7 strands

6. Protein Non-fluorescent flavoprotein (luxF, FP390) [51684] (2 species)

7. Species Photobacterium phosphoreum [TaxId:659] [51686] (1 PDB entry)

8. Domain d1fvpa_: 1fvp A: [29556]
   complexed with fma

Details for d1fvpa_

PDB Entry: 1fvp, 2.7 Å

PDB Description: flavoprotein 390

PDB Compounds: (A:) flavoprotein 390

SCOPe Domain Sequences for d1fvpa_:

Sequence; same for both SEQRES and ATOM records:

>d1fvpa_ c.1.16.2 (A:) Non-fluorescent flavoprotein (luxF, FP390) {Photobacterium phosphoreum [TaxId: 659]}
mnkwnygvffvnfynkgqqepsktmnnaletlriidedtsiydviniddhylvkkdsedk
klapfitlgeklyvlatsentvdiaakyalplvfkwddineerlkllsfynasaskynkn
idlvrhqlmlhvnvneaetvakeelklyienyvactqpsnfngsidsiiqsnvtgsykdc
lsyvanlagkfdntvdfllcfesmqdqnkkksvmidlnnqvikfrqdnnli

Timeline for d1fvpa_:

• d1fvpa_ first appeared (with stable ids) in SCOP 1.55
  
• d1fvpa_ appears in SCOPe 2.05
  
• d1fvpa_ appears in SCOPe 2.07
  
• d1fvpa_ appears in the current release, SCOPe 2.08