SCOPe 2.08: Domain d1nfpa_: 1nfp A:

Lineage for d1nfpa_ (1nfp A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families)
   consists of clearly related families of somewhat different folds

5. Family c.1.16.2: Non-fluorescent flavoprotein (luxF, FP390) [51683] (2 proteins)
   incomplete beta/alpha barrel with mixed beta-sheet of 7 strands

6. Protein Non-fluorescent flavoprotein (luxF, FP390) [51684] (2 species)

7. Species Photobacterium leiognathi [TaxId:553611] [51685] (1 PDB entry)

8. Domain d1nfpa_: 1nfp A: [29555]
   complexed with fmn, myr, so4

Details for d1nfpa_

PDB Entry: 1nfp, 1.6 Å

PDB Description: structural refinement of the non-fluorescent flavoprotein from photobacterium leiognathi at 1.60 angstroms resolution

PDB Compounds: (A:) luxf gene product

SCOPe Domain Sequences for d1nfpa_:

Sequence; same for both SEQRES and ATOM records:

>d1nfpa_ c.1.16.2 (A:) Non-fluorescent flavoprotein (luxF, FP390) {Photobacterium leiognathi [TaxId: 553611]}
mtkwnygvfflnfyhvgqqepsltmsnaletlriidedtsiydvvafsehhidksyndet
klapfvslgkqihvlatspetvvkaakygmpllfkwddsqqkriellnhyqaaaakfnvd
ianvrhrlmlfvnvndnptqakaelsiyledylsytqaetsideiinsnaagnfdtclhh
vaemaqglnnkvdflfcfesmkdqenkkslminfdkrvinyrkehnln

Timeline for d1nfpa_:

• d1nfpa_ first appeared (with stable ids) in SCOP 1.55, called d1nfp__
  
• d1nfpa_ appears in SCOPe 2.07