SCOPe 2.07: Domain d1brlb_: 1brl B:

Lineage for d1brlb_ (1brl B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families)
   consists of clearly related families of somewhat different folds

5. Family c.1.16.1: Bacterial luciferase (alkanal monooxygenase) [51680] (3 proteins)
   typical (beta/alpha)8-barrel fold
   heterodimer of two similar chains

6. Protein Bacterial luciferase beta chain, LuxB [88707] (1 species)

7. Species Vibrio harveyi [TaxId:669] [88708] (4 PDB entries)

8. Domain d1brlb_: 1brl B: [29554]
   Other proteins in same PDB: d1brla_, d1brlc_
   heterodimer with alpha chain
   complexed with po4

Details for d1brlb_

PDB Entry: 1brl, 2.4 Å

PDB Description: three-dimensional structure of bacterial luciferase from vibrio harveyi at 2.4 angstroms resolution

PDB Compounds: (B:) bacterial luciferase

SCOPe Domain Sequences for d1brlb_:

Sequence; same for both SEQRES and ATOM records:

>d1brlb_ c.1.16.1 (B:) Bacterial luciferase beta chain, LuxB {Vibrio harveyi [TaxId: 669]}
mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag
fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp
tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv
ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar
aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe
smedkaqqravidvvnani

Timeline for d1brlb_:

• d1brlb_ first appeared (with stable ids) in SCOP 1.55
  
• d1brlb_ appears in SCOPe 2.06
  
• d1brlb_ appears in the current release, SCOPe 2.08