Lineage for d1brla_ (1brl A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19790Superfamily c.1.16: Bacterial luciferase-like [51679] (3 families) (S)
  5. 19791Family c.1.16.1: Bacterial luciferase (alkanal monooxygenase) [51680] (1 protein)
  6. 19792Protein Bacterial luciferase (alkanal monooxygenase) [51681] (1 species)
  7. 19793Species Vibrio harveyi [TaxId:669] [51682] (4 PDB entries)
  8. 19800Domain d1brla_: 1brl A: [29553]

Details for d1brla_

PDB Entry: 1brl (more details), 2.4 Å

PDB Description: three-dimensional structure of bacterial luciferase from vibrio harveyi at 2.4 angstroms resolution

SCOP Domain Sequences for d1brla_:

Sequence, based on SEQRES records: (download)

>d1brla_ c.1.16.1 (A:) Bacterial luciferase (alkanal monooxygenase) {Vibrio harveyi}
mkfgnflltyqppelsqtevmkrlvnlgkasegcgfdtvwllehhftefgllgnpyvaaa
hllgatetlnvgtaaivlptahpvrqaedvnlldqmskgrfrfgicrglydkdfrvfgtd
mdnsralmdcwydlmkegfnegyiaadnehikfpkiqlnpsaytqggapvyvvaesastt
ewaaerglpmilswiinthekkaqldlynevatehgydvtkidhclsyitsvdhdsnrak
dicrnflghwydsyvnatkifddsdqtkgydfnkgqwrdfvlkghkdtnrridysyeinp
vgtpeeciaiiqqdidatgidniccgfeangseeeiiasmklfqsdvmpylkekq

Sequence, based on observed residues (ATOM records): (download)

>d1brla_ c.1.16.1 (A:) Bacterial luciferase (alkanal monooxygenase) {Vibrio harveyi}
mkfgnflltyqppelsqtevmkrlvnlgkasegcgfdtvwllehhftefgllgnpyvaaa
hllgatetlnvgtaaivlptahpvrqaedvnlldqmskgrfrfgicrglydkdfrvfgtd
mdnsralmdcwydlmkegfnegyiaadnehikfpkiqlnpsaytqggapvyvvaesastt
ewaaerglpmilswiinthekkaqldlynevatehgydvtkidhclsyitsvdhdsnrak
dicrnflghwydsyvnatkifddsdqtkgyddtnrridysyeinpvgtpeeciaiiqqdi
datgidniccgfeangseeeiiasmklfqsdvmpylkekq

SCOP Domain Coordinates for d1brla_:

Click to download the PDB-style file with coordinates for d1brla_.
(The format of our PDB-style files is described here.)

Timeline for d1brla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1brlb_