Lineage for d3tl8d_ (3tl8 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (37 species)
    not a true protein
  7. 2987381Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188319] (26 PDB entries)
  8. 2987399Domain d3tl8d_: 3tl8 D: [295524]
    automated match to d3tl8h_

Details for d3tl8d_

PDB Entry: 3tl8 (more details), 2.5 Å

PDB Description: The AvrPtoB-BAK1 complex reveals two structurally similar kinaseinteracting domains in a single type III effector
PDB Compounds: (D:) BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1

SCOPe Domain Sequences for d3tl8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tl8d_ d.144.1.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lkrfslrelqvasdnfsnknilgrggfgkvykgrladgtlvavkrlkeertqggelqfqt
evemismavhrnllrlrgfcmtpterllvypymangsvasclrerpesqppldwpkrqri
algsarglaylhdhcdpkiihrdvkaanilldeefeavvgdfglaklmdykdthvttavr
gtighiapeylstgkssektdvfgygvmllelitgqrafdlarlandddvmlldwvkgll
kekklealvdvdlqgnykdeeveqliqvallctqsspmerpkmsevvrmlegdglaerwe
ewqkeemfrq

SCOPe Domain Coordinates for d3tl8d_:

Click to download the PDB-style file with coordinates for d3tl8d_.
(The format of our PDB-style files is described here.)

Timeline for d3tl8d_: