Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) consists of clearly related families of somewhat different folds |
Family c.1.16.1: Bacterial luciferase (alkanal monooxygenase) [51680] (3 proteins) typical (beta/alpha)8-barrel fold heterodimer of two similar chains |
Protein Bacterial luciferase beta chain, LuxB [88707] (1 species) |
Species Vibrio harveyi [TaxId:669] [88708] (4 PDB entries) |
Domain d1xkjb_: 1xkj B: [29552] beta2 homodimer |
PDB Entry: 1xkj (more details), 2.5 Å
SCOPe Domain Sequences for d1xkjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xkjb_ c.1.16.1 (B:) Bacterial luciferase beta chain, LuxB {Vibrio harveyi [TaxId: 669]} mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe smedkaqqravidvvnanivkyhs
Timeline for d1xkjb_: