Lineage for d1xkja_ (1xkj A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2448077Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 2448078Family c.1.16.1: Bacterial luciferase (alkanal monooxygenase) [51680] (3 proteins)
    typical (beta/alpha)8-barrel fold
    heterodimer of two similar chains
  6. 2448084Protein Bacterial luciferase beta chain, LuxB [88707] (1 species)
  7. 2448085Species Vibrio harveyi [TaxId:669] [88708] (4 PDB entries)
  8. 2448089Domain d1xkja_: 1xkj A: [29551]
    beta2 homodimer

Details for d1xkja_

PDB Entry: 1xkj (more details), 2.5 Å

PDB Description: bacterial luciferase beta2 homodimer
PDB Compounds: (A:) beta2 luciferase

SCOPe Domain Sequences for d1xkja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xkja_ c.1.16.1 (A:) Bacterial luciferase beta chain, LuxB {Vibrio harveyi [TaxId: 669]}
mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag
fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp
tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv
ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar
aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe
smedkaqqravidvvnanivkyhs

SCOPe Domain Coordinates for d1xkja_:

Click to download the PDB-style file with coordinates for d1xkja_.
(The format of our PDB-style files is described here.)

Timeline for d1xkja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xkjb_