Lineage for d1xkja_ (1xkj A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.16: Bacterial luciferase-like [51679] (3 families) 
Family c.1.16.1: Bacterial luciferase (alkanal monooxygenase) [51680] (1 protein) Protein Bacterial luciferase (alkanal monooxygenase) [51681] (1 species) Species Vibrio harveyi [TaxId:669] [51682] (4 PDB entries) 
Domain d1xkja_: 1xkj A: [29551]
Details for d1xkja_
PDB Entry: 1xkj (more details), 2.5 Å
PDB Description: bacterial luciferase beta2 homodimer
SCOP Domain Sequences for d1xkja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xkja_ c.1.16.1 (A:) Bacterial luciferase (alkanal monooxygenase) {Vibrio harveyi}
mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag
fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp
tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv
ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar
aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe
smedkaqqravidvvnanivkyhs
SCOP Domain Coordinates for d1xkja_:
Click to download the PDB-style file with coordinates for d1xkja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xkja_:
- d1xkja_ appears in SCOP 1.57
- d1xkja_ appears in the current release, SCOPe 2.08
View in 3D
