SCOP 1.75: Domain d1lucb_: 1luc B:

Lineage for d1lucb_ (1luc B:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.16: Bacterial luciferase-like [51679] (4 families)
   consists of clearly related families of somewhat different folds

5. Family c.1.16.1: Bacterial luciferase (alkanal monooxygenase) [51680] (2 proteins)
   typical (beta/alpha)8-barrel fold
   heterodimer of two similar chains

6. Protein Bacterial luciferase beta chain, LuxB [88707] (1 species)

7. Species Vibrio harveyi [TaxId:669] [88708] (4 PDB entries)

8. Domain d1lucb_: 1luc B: [29548]
   Other proteins in same PDB: d1luca_
   heterodimer with alpha chain
   complexed with edo, mg

Details for d1lucb_

PDB Entry: 1luc, 1.5 Å

PDB Description: bacterial luciferase

PDB Compounds: (B:) bacterial luciferase

SCOP Domain Sequences for d1lucb_:

Sequence; same for both SEQRES and ATOM records:

>d1lucb_ c.1.16.1 (B:) Bacterial luciferase beta chain, LuxB {Vibrio harveyi [TaxId: 669]}
mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag
fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp
tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv
ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar
aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe
smedkaqqravidvvnaniv

Timeline for d1lucb_:

• d1lucb_ first appeared (with stable ids) in SCOP 1.55
  
• d1lucb_ appears in SCOP 1.73
  
• d1lucb_ appears in SCOPe 2.01
  
• d1lucb_ appears in the current release, SCOPe 2.08