![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.16: Bacterial luciferase-like [51679] (4 families) ![]() consists of clearly related families of somewhat different folds |
![]() | Family c.1.16.1: Bacterial luciferase (alkanal monooxygenase) [51680] (2 proteins) typical (beta/alpha)8-barrel fold heterodimer of two similar chains |
![]() | Protein Bacterial luciferase beta chain, LuxB [88707] (1 species) |
![]() | Species Vibrio harveyi [TaxId:669] [88708] (4 PDB entries) |
![]() | Domain d1lucb_: 1luc B: [29548] Other proteins in same PDB: d1luca_ heterodimer with alpha chain complexed with edo, mg |
PDB Entry: 1luc (more details), 1.5 Å
SCOP Domain Sequences for d1lucb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lucb_ c.1.16.1 (B:) Bacterial luciferase beta chain, LuxB {Vibrio harveyi [TaxId: 669]} mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe smedkaqqravidvvnaniv
Timeline for d1lucb_: