Lineage for d1luca_ (1luc A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089162Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 2089163Family c.1.16.1: Bacterial luciferase (alkanal monooxygenase) [51680] (3 protein domains)
    typical (beta/alpha)8-barrel fold
    heterodimer of two similar chains
  6. 2089164Protein Bacterial luciferase alpha chain, LuxA [88705] (1 species)
  7. 2089165Species Vibrio harveyi [TaxId:669] [88706] (2 PDB entries)
  8. 2089166Domain d1luca_: 1luc A: [29547]
    Other proteins in same PDB: d1lucb_
    heterodimer with beta chain
    complexed with edo, mg

Details for d1luca_

PDB Entry: 1luc (more details), 1.5 Å

PDB Description: bacterial luciferase
PDB Compounds: (A:) bacterial luciferase

SCOPe Domain Sequences for d1luca_:

Sequence, based on SEQRES records: (download)

>d1luca_ c.1.16.1 (A:) Bacterial luciferase alpha chain, LuxA {Vibrio harveyi [TaxId: 669]}
mkfgnflltyqppelsqtevmkrlvnlgkasegcgfdtvwllehhftefgllgnpyvaaa
hllgatetlnvgtaaivlptahpvrqaedvnlldqmskgrfrfgicrglydkdfrvfgtd
mdnsralmdcwydlmkegfnegyiaadnehikfpkiqlnpsaytqggapvyvvaesastt
ewaaerglpmilswiinthekkaqldlynevatehgydvtkidhclsyitsvdhdsnrak
dicrnflghwydsyvnatkifddsdqtkgydfnkgqwrdfvlkghkdtnrridysyeinp
vgtpeeciaiiqqdidatgidniccgfeangseeeiiasmklfqsdvmpylkekq

Sequence, based on observed residues (ATOM records): (download)

>d1luca_ c.1.16.1 (A:) Bacterial luciferase alpha chain, LuxA {Vibrio harveyi [TaxId: 669]}
mkfgnflltyqppelsqtevmkrlvnlgkasegcgfdtvwllehhftefgllgnpyvaaa
hllgatetlnvgtaaivlptahpvrqaedvnlldqmskgrfrfgicrglydkdfrvfgtd
mdnsralmdcwydlmkegfnegyiaadnehikfpkiqlnpsaytqggapvyvvaesastt
ewaaerglpmilswiinthekkaqldlynevatehgydvtkidhclsyitsvdhdsnrak
dicrnflghwydsyvnatkifridysyeinpvgtpeeciaiiqqdidatgidniccgfea
ngseeeiiasmklfqsdvmpylkekq

SCOPe Domain Coordinates for d1luca_:

Click to download the PDB-style file with coordinates for d1luca_.
(The format of our PDB-style files is described here.)

Timeline for d1luca_: