Lineage for d1bxcc_ (1bxc C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839044Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2839095Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 2839096Protein D-xylose isomerase [51666] (13 species)
  7. 2839339Species Thermus aquaticus, subsp. Caldophilus [TaxId:271] [51677] (1 PDB entry)
  8. 2839342Domain d1bxcc_: 1bxc C: [29541]

Details for d1bxcc_

PDB Entry: 1bxc (more details), 2.3 Å

PDB Description: xylose isomerase from thermus caldophilus
PDB Compounds: (C:) xylose isomerase

SCOPe Domain Sequences for d1bxcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxcc_ c.1.15.3 (C:) D-xylose isomerase {Thermus aquaticus, subsp. Caldophilus [TaxId: 271]}
myepkpehrftfglwtvgnvgrdpfgdavrerldpvyvghklaelgvhgvnlhdedlipr
gtppqerdqivrrfkraldetglkvpmvtgnlfsdpgfkdggftsrdpwvrayafrksle
tmdlgaelgaeiyvvwpgregaeveatgkarkvwdwvreplnfmaayaedqgygyrfale
pkpneprgdiyfatvgsmlalihtlerperfglnpefahetmaglnfvhavaqaldagkl
lhidlngqrmnrfdqdlrfgsenlkaafllvdllessgyqgprhfdahalrtedeegvwa
fargcmrtylilkeraeafredpevkellaayyqedpaalplmdpyshekaealkraelp
leakrhrgyalerldqlaveyllgvrg

SCOPe Domain Coordinates for d1bxcc_:

Click to download the PDB-style file with coordinates for d1bxcc_.
(The format of our PDB-style files is described here.)

Timeline for d1bxcc_: