Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.15: Xylose isomerase-like [51658] (6 families) different families share similar but non-identical metal-binding sites |
Family c.1.15.3: Xylose isomerase [51665] (1 protein) |
Protein D-xylose isomerase [51666] (12 species) |
Species Bacillus stearothermophilus [TaxId:1422] [51675] (1 PDB entry) |
Domain d1a0db_: 1a0d B: [29534] |
PDB Entry: 1a0d (more details), 3 Å
SCOP Domain Sequences for d1a0db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a0db_ c.1.15.3 (B:) D-xylose isomerase {Bacillus stearothermophilus} pyfdnistiayegpasknplafkfynpeekvgdktmeehlrfsvaywhtftgdgsdpfga gnmirpwnkysgmdlakarveaafeffeklnipffcfhdvdiapegetlketyknldiiv dmieeymktsktkllwntanlfthprfvhgaatscnadvfayaaakvkkgleiakrlgae nyvfwggregyetllntdmkleldnlarflhmavdyakeigfdgqfliepkpkeptkhqy dfdvatalaflqtyglkdyfkfnieanhatlaghtfehelrvarihgmlgsvdanqgdml lgwdtdefptdlysttlamyeilkngglgrgglnfdakvrrgsfepedlfyahiagmdsf avglkvahrliedrvfdefieeryksytegigreivegtadfhkleahalqlgeiqnqsg rqerlktllnqyllevc
Timeline for d1a0db_: