Lineage for d1a0db_ (1a0d B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65755Superfamily c.1.15: Xylose isomerase-like [51658] (3 families) (S)
  5. 65776Family c.1.15.3: Xylose isomerase [51665] (1 protein)
  6. 65777Protein D-xylose isomerase [51666] (12 species)
  7. 65870Species Bacillus stearothermophilus [TaxId:1422] [51675] (1 PDB entry)
  8. 65872Domain d1a0db_: 1a0d B: [29534]

Details for d1a0db_

PDB Entry: 1a0d (more details), 3 Å

PDB Description: xylose isomerase from bacillus stearothermophilus

SCOP Domain Sequences for d1a0db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0db_ c.1.15.3 (B:) D-xylose isomerase {Bacillus stearothermophilus}
pyfdnistiayegpasknplafkfynpeekvgdktmeehlrfsvaywhtftgdgsdpfga
gnmirpwnkysgmdlakarveaafeffeklnipffcfhdvdiapegetlketyknldiiv
dmieeymktsktkllwntanlfthprfvhgaatscnadvfayaaakvkkgleiakrlgae
nyvfwggregyetllntdmkleldnlarflhmavdyakeigfdgqfliepkpkeptkhqy
dfdvatalaflqtyglkdyfkfnieanhatlaghtfehelrvarihgmlgsvdanqgdml
lgwdtdefptdlysttlamyeilkngglgrgglnfdakvrrgsfepedlfyahiagmdsf
avglkvahrliedrvfdefieeryksytegigreivegtadfhkleahalqlgeiqnqsg
rqerlktllnqyllevc

SCOP Domain Coordinates for d1a0db_:

Click to download the PDB-style file with coordinates for d1a0db_.
(The format of our PDB-style files is described here.)

Timeline for d1a0db_: