SCOP 1.71: Domain d1a0cc_: 1a0c C:

Lineage for d1a0cc_ (1a0c C:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.15: Xylose isomerase-like [51658] (6 families)
   different families share similar but non-identical metal-binding sites

5. Family c.1.15.3: Xylose isomerase [51665] (1 protein)

6. Protein D-xylose isomerase [51666] (12 species)

7. Species Clostridium thermosulfurogenes, also known as Thermoanaerobacter thermosulfurigenes [TaxId:33950] [51674] (1 PDB entry)

8. Domain d1a0cc_: 1a0c C: [29531]

Details for d1a0cc_

PDB Entry: 1a0c, 2.5 Å

PDB Description: xylose isomerase from thermoanaerobacterium thermosulfurigenes

SCOP Domain Sequences for d1a0cc_:

Sequence; same for both SEQRES and ATOM records:

>d1a0cc_ c.1.15.3 (C:) D-xylose isomerase {Clostridium thermosulfurogenes, also known as Thermoanaerobacter thermosulfurigenes}
nkyfenvskikyegpksnnpysfkfynpeevidgktmeehlrfsiaywhtftadgtdqfg
katmqrpwnhytdpmdiakarveaafeffdkinapyfcfhdrdiapegdtlretnknldt
ivamikdylktsktkvlwgtanlfsnprfvhgastscnadvfaysaaqvkkaleitkelg
genyvfwggregyetllntdmefeldnfarflhmavdyakeigfegqfliepkpkeptkh
qydfdvanvlaflrkydldkyfkvnieanhatlafhdfqhelryaringvlgsidantgd
mllgwdtdqfptdirmttlamyevikmggfdkgglnfdakvrrasfepedlflghiagmd
afakgfkvayklvkdrvfdkfieeryasykdgigadivsgkadfrslekyalersqivnk
sgrqellesilnqylfa

Timeline for d1a0cc_:

• d1a0cc_ first appeared (with stable ids) in SCOP 1.55
  
• d1a0cc_ appears in SCOP 1.69
  
• d1a0cc_ appears in SCOP 1.73
  
• d1a0cc_ appears in the current release, SCOPe 2.08