Lineage for d5ximd_ (5xim D:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19614Superfamily c.1.15: Xylose isomerase-like [51658] (3 families) (S)
  5. 19635Family c.1.15.3: Xylose isomerase [51665] (1 protein)
  6. 19636Protein D-xylose isomerase [51666] (12 species)
  7. 19637Species Actinoplanes missouriensis [TaxId:1866] [51673] (14 PDB entries)
  8. 19689Domain d5ximd_: 5xim D: [29524]

Details for d5ximd_

PDB Entry: 5xim (more details), 2.6 Å

PDB Description: protein engineering of xylose (glucose) isomerase from actinoplanes missouriensis. 1. crystallography and site-directed mutagenesis of metal binding sites

SCOP Domain Sequences for d5ximd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ximd_ c.1.15.3 (D:) D-xylose isomerase {Actinoplanes missouriensis}
vqatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpfg
sdaqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlrq
mdlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaiep
kpneprgdillptaghaiafvqelerpelfginpetgheqmsnlnftqgiaqalwhkklf
hidlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprhfdykpsrtedyd
gvwesakanirmylllkerakafradpevqealaaskvaelktptlnpgegyaelladrs
afedydadavgakgfgfvklnqlaiehllgar

SCOP Domain Coordinates for d5ximd_:

Click to download the PDB-style file with coordinates for d5ximd_.
(The format of our PDB-style files is described here.)

Timeline for d5ximd_: