SCOPe 2.06: Domain d3rnkb_: 3rnk B:

Lineage for d3rnkb_ (3rnk B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)

8. Domain d3rnkb_: 3rnk B: [295044]
   Other proteins in same PDB: d3rnka_
   automated match to d5c3ta_
   mutant

Details for d3rnkb_

PDB Entry: 3rnk, 1.74 Å

PDB Description: crystal structure of the complex between mouse pd-1 mutant and pd-l2 igv domain

PDB Compounds: (B:) Programmed cell death 1 ligand 2

SCOPe Domain Sequences for d3rnkb_:

Sequence; same for both SEQRES and ATOM records:

>d3rnkb_ b.1.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lftvtapkevytvdvgssvslecdfdrrectelegiraslqkvendtslqseratlleeq
lplgkalfhipsvqvrdsgqyrclvicgaawdykyltvkvkasy

Timeline for d3rnkb_:

• d3rnkb_ is new in SCOPe 2.06-stable
  
• d3rnkb_ appears in SCOPe 2.07
  
• d3rnkb_ appears in the current release, SCOPe 2.08