Lineage for d3rnkb_ (3rnk B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759818Domain d3rnkb_: 3rnk B: [295044]
    Other proteins in same PDB: d3rnka_
    automated match to d5c3ta_
    mutant

Details for d3rnkb_

PDB Entry: 3rnk (more details), 1.74 Å

PDB Description: crystal structure of the complex between mouse pd-1 mutant and pd-l2 igv domain
PDB Compounds: (B:) Programmed cell death 1 ligand 2

SCOPe Domain Sequences for d3rnkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rnkb_ b.1.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lftvtapkevytvdvgssvslecdfdrrectelegiraslqkvendtslqseratlleeq
lplgkalfhipsvqvrdsgqyrclvicgaawdykyltvkvkasy

SCOPe Domain Coordinates for d3rnkb_:

Click to download the PDB-style file with coordinates for d3rnkb_.
(The format of our PDB-style files is described here.)

Timeline for d3rnkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3rnka_