Lineage for d2xinc_ (2xin C:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 573481Superfamily c.1.15: Xylose isomerase-like [51658] (6 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 573502Family c.1.15.3: Xylose isomerase [51665] (1 protein)
  6. 573503Protein D-xylose isomerase [51666] (12 species)
  7. 573504Species Actinoplanes missouriensis [TaxId:1866] [51673] (14 PDB entries)
  8. 573535Domain d2xinc_: 2xin C: [29495]

Details for d2xinc_

PDB Entry: 2xin (more details), 2.3 Å

PDB Description: protein engineering of xylose (glucose) isomerase from actinoplanes missouriensis. 1. crystallography and site-directed mutagenesis of metal binding sites

SCOP Domain Sequences for d2xinc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xinc_ c.1.15.3 (C:) D-xylose isomerase {Actinoplanes missouriensis}
vqatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpfg
sdaqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlrq
mdlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaiep
kpneprgdillptaghaiafvqelerpelfginpetgheqmsnlnftqgiaqalwhkklf
hidlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprnfdykpsrtedyd
gvwesakanirmylllkerakafradpevqealaaskvaelktptlnpgegyaelladrs
afedydadavgakgfgfvklnqlaiehllgar

SCOP Domain Coordinates for d2xinc_:

Click to download the PDB-style file with coordinates for d2xinc_.
(The format of our PDB-style files is described here.)

Timeline for d2xinc_: