Lineage for d4ximc_ (4xim C:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 685236Superfamily c.1.15: Xylose isomerase-like [51658] (7 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 685259Family c.1.15.3: Xylose isomerase [51665] (1 protein)
  6. 685260Protein D-xylose isomerase [51666] (12 species)
  7. 685261Species Actinoplanes missouriensis [TaxId:1866] [51673] (14 PDB entries)
  8. 685276Domain d4ximc_: 4xim C: [29487]

Details for d4ximc_

PDB Entry: 4xim (more details), 2.3 Å

PDB Description: protein engineering of xylose (glucose) isomerase from actinoplanes missouriensis. 1. crystallography and site-directed mutagenesis of metal binding sites
PDB Compounds: (C:) d-xylose isomerase

SCOP Domain Sequences for d4ximc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ximc_ c.1.15.3 (C:) D-xylose isomerase {Actinoplanes missouriensis [TaxId: 1866]}
qatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpfgs
daqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlrqm
dlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaiepk
pneprgdillptaghaiafvqelerpelfginpetgheqmsnlnftqgiaqalwhkklfh
idlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprhfdykpsrtedydg
vwesakanirmylllkerakafradpevqealaaskvaelktptlnpgegyaelladrsa
fedydadavgakgfgfvklnqlaiehllgar

SCOP Domain Coordinates for d4ximc_:

Click to download the PDB-style file with coordinates for d4ximc_.
(The format of our PDB-style files is described here.)

Timeline for d4ximc_: